PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06127g01010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 295aa    MW: 32685.2 Da    PI: 8.1609
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06127g01010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.24.9e-403697263
                    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                              +e+a+kcprCds+ntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  Niben101Scf06127g01010.1 36 PEQAQKCPRCDSSNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNKRSSS 97
                              68999*****************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.2E-333894IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3114094IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104278IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-244493IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDPSNGQHHH QELSSQTLES MLVSTKPQQD KKPKPPEQAQ KCPRCDSSNT KFCYYNNYSL  60
SQPRYFCKSC RRYWTKGGTL RNVPVGGGCR KNKRSSSRSS SQDHSINTNP INPLSSLTTP  120
MSYDSTDLSL AFARLQKQGN GHLGIENHNI SLMCNGTNIA PSEIQSGYFD ALRGGFLENP  180
NGFHQNLYYG VGNMGHHVEN GGMGVNNISD QEMGCMHYDQ EISSGVTTTA TTVTTVKQEM  240
CSMARDQGDN RVLWGFPWQI NNGNGNMSAD FDSSRRIWNG VGGNSWHGLL NSPLM
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009622795.10.0PREDICTED: dof zinc finger protein DOF2.1-like
RefseqXP_016492247.10.0PREDICTED: dof zinc finger protein DOF2.1-like
TrEMBLM1AC181e-133M1AC18_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000194161e-133(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.13e-42Dof family protein